PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011094924.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 587aa    MW: 65043.9 Da    PI: 7.149
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011094924.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093854221954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  XP_011094924.1 385 FEHflHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 422
                     554459******************************88 PP

2BELL99.42.8e-32254322472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e  +kk++Lls+l+eV+krYkqy++q+q+ +++Fe vagl  a+p+++lAlka+S+hFr+Lk+ai++q+
  XP_011094924.1 254 EQTRKKSRLLSMLHEVYKRYKQYYQQMQAAVAAFESVAGLSGAAPFANLALKAMSKHFRSLKNAITDQL 322
                     7789**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.6E-41187320IPR006563POX domain
PfamPF075267.8E-34194319IPR006563POX domain
PROSITE profilePS5007112.098363426IPR001356Homeobox domain
SMARTSM003897.3E-10366430IPR001356Homeobox domain
CDDcd000861.28E-12366427No hitNo description
SuperFamilySSF466895.56E-17368434IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-27369430IPR009057Homeodomain-like
PfamPF059201.5E-18383422IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MAEGLESYHV PQQSRRDKLR VNNHSPACLD NLQSCCAPLL SAHDPPLISS DFNLHRQSFS  60
LAPNTNAGVK EEGMNLMGFV GGNHHMYVDP QLGPLQLNPT SIQDISGSPC VYAAPSPHCY  120
RGLLLDQSFH GNEVVVYKPD QTLSIPHQHP NPNSSTAATN AQSLSLSLSS HHSNNLPLEL  180
NLQRYESSMF SNNKGSRFLK PAQQLLEELC DVGRGIGIYA EKIGADSFLL DPPPMESLSG  240
IVDDPLNFST DGGEQTRKKS RLLSMLHEVY KRYKQYYQQM QAAVAAFESV AGLSGAAPFA  300
NLALKAMSKH FRSLKNAITD QLQFTTKSHG KINCERDETH GLESSGKSTY GERTFQSTGF  360
IDQPVWRPQR GLPERAVTVL RAWLFEHFLH PYPTDTDKLM LAKQTGLSRN QVSNWFINAR  420
VRLWKPMVEE IHMLETRQSQ KPSQREEQPP NRLNDHLPTS CSIECENAST SVQRIGEIPS  480
KRNREDPTGT ATRGNEGPMR FSYDNLLHNP WLGVGVSHTG GNGGVSLTLG LHQNGMGLSD  540
PYPINAARRF GLESQGDGYV ASGFAAQNRQ FGRDINMDGQ LMHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15372430563Homeobox protein Meis2
3k2a_B1e-15372430563Homeobox protein Meis2
4xrs_A6e-16372429158Homeobox protein Meis1
4xrs_B6e-16372429158Homeobox protein Meis1
5bng_A7e-16372430159Homeobox protein Meis2
5bng_B7e-16372430159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094924.10.0PREDICTED: BEL1-like homeodomain protein 9 isoform X2
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-80TALE family protein